PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g29936.1.p
Common NameBRADI_4g29936, LOC106866612
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 383aa    MW: 43981.7 Da    PI: 6.3556
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g29936.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR167.24.3e-21157282191
              FAR1   1 kfYneYAkevGFsvrkskskks...krngeitkrtfvCskegkreeekkk.................................tekerrtrae 57 
                       kfYn+YA +vGFs+ ++++++s   ++ g++t+ t +C+k gk++ee+ +                                 ++  rrt+++
  Bradi4g29936.1.p 157 KFYNNYAMKVGFSTAIAHKYHSrnkTHMGKVTRVTITCNKAGKPTEEDMEankeaaqrgeglgknkpakrrvrktkegtnderNVLMRRTNTV 249
                       6*******************99554456789****************9999***************************98887777888**** PP

              FAR1  58 trtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         t C a+++v    d++w++t+l+l HnHel p
  Bradi4g29936.1.p 250 VLTACPATMVVAYI-DDVWKITRLDLTHNHELHP 282
                       **************.9***************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.4E-19157282IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MTWLLADHNF SEYIDDHSFY ITSDRNININ HLEQEELENM YNMQNQISVP ETLAEKHVED  60
HGDWMQSDEP ENILNPDELE AEAGDIPSMD TENAENNNER NPETDPEGNK EPLTQEEVIE  120
FIQSSQQLGQ GGAAQEIEHM HMPELGMVFK TEEEGHKFYN NYAMKVGFST AIAHKYHSRN  180
KTHMGKVTRV TITCNKAGKP TEEDMEANKE AAQRGEGLGK NKPAKRRVRK TKEGTNDERN  240
VLMRRTNTVV LTACPATMVV AYIDDVWKIT RLDLTHNHEL HPPGEARFLR SHKNMTLEEK  300
LMIRTCSACK LPTRKIMAIL AYMRGGLSSL PYTKKDVSNI RTSIRTESGR SDMMKVLEYF  360
LKKKEKMQLS FTKLTRMKRA EF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225231RRVRKTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757548.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
RefseqXP_014757549.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like
TrEMBLA0A0Q3HA030.0A0A0Q3HA03_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1517079
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-16FAR1-related sequence 5